.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ksd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title High-speed NMR structure determination of membrane domains of histidine kinase receptors. To be Published
    Site CSMP
    PDB Id 2ksd Target Id 4310C
    Molecular Characteristics
    Source Cdna
    Alias Ids TPS31340,P0AEC3 Molecular Weight 13290.34 Da.
    Residues 115 Isoelectric Point 8.09
    Sequence mkqirllaqyyvdlmmklglvrfsmllalalvvlaivvqmavtmvlhgqvesidvirsiffgllitpwa vyflsvvveqleesrqrlsrlvqkleemrerdlslnvqlkdniaql
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch