The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title High-speed NMR structure determination of membrane domains of histidine kinase receptors. To be Published
    Site CSMP
    PDB Id 2ksf Target Id 4312C
    Molecular Characteristics
    Source Cdna
    Alias Ids TPS31342,P21865 Molecular Weight 11471.26 Da.
    Residues 107 Isoelectric Point 5.79
    Sequence mvqiqgcvvaaalcavitliamqwlmafdaanlvmlyllgvvvvalfygrwpsvvatvinvvsfdlffi aprgtlavsdvqylltfavmltvglvignltagvryqa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch