The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of aquaporin inhibition by mercury. J.Mol.Biol. 368 607-617 2007
    Site CSMP
    PDB Id 2o9d Target Id 2454S
    Molecular Characteristics
    Source Genomic
    Alias Ids TPS31334,P60844 Molecular Weight 23701.43 Da.
    Residues 231 Isoelectric Point 6.96
    Sequence mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgghfnpavtig lwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasngygehspggysmlsalvve lvlsagfllvihgatdkfapagfapiaiglaltlihlisipvtntsvnparstavaifqggwaleqlwf fwvvpivggiiggliyrtllekrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.238
    Matthews' coefficent 3.48 Rfactor 0.197
    Waters 96 Solvent Content 64.68

    Ligand Information
    Ligands HSG (OCTYL) x 2;HSH (OCTYL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch