The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Cytoplasmic Segment of Histidine Kinase Receptor QseC, a Key Player in Bacterial Virulence. Protein Pept.Lett. 2010
    Site CSMP
    PDB Id 3jz3 Target Id 4308C
    Molecular Characteristics
    Alias Ids TPS31337,P40719 Molecular Weight 23537.37 Da.
    Residues 214 Isoelectric Point 6.24
    Sequence rerrftsdaahelrspltalkvqtevaqlsdddpqarkkallqlhsgidratrlvdqlltlsrldsldn lqdvaeipledllqssvmdiyhtaqqakidvrltlnahsikrtgqplllsllvrnlldnavryspqgsv vdvtlnadnfivrdngpgvtpealarigerfyrppgqtatgsglglsivqriaklhgmnvefgnaeqgg feakvsw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.26234
    Matthews' coefficent 2.23 Rfactor 0.22826
    Waters 44 Solvent Content 44.91

    Ligand Information
    Ligands SO4 (SULFATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch