The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved hypothetical protein, rv2844, from Mycobacterium tuberculosis. To be Published
    Site ISFI
    PDB Id 2ib0 Target Id ISFI195
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS11926, Molecular Weight 16939.00 Da.
    Residues 162 Isoelectric Point 5.47
    Sequence mtssepahgatpkrspsegsadnaalcdalavehatiygygivsalsppgvnflvadalkqhrhrrddv ivmlsargvtapiaaagyqlpmqvssaadaarlavrmendgatawravvehaetaddrvfastaltesa vmatrwnrvlgawpitaafpggde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.235
    Matthews' coefficent 3.04 Rfactor 0.202
    Waters 158 Solvent Content 59.55

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch