The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of OMPR-C DNA Binding Protein. To be Published
    Site ISFI
    PDB Id 2jpb Target Id ISFI333
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11927, Molecular Weight 11878.11 Da.
    Residues 104 Isoelectric Point 9.16
    Sequence aviafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreysamersidvq isrlrrmveedpahpryiqtvwglgyvfvpdgska
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch