.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g5o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the toxin-antitoxin complex RelBE2 (Rv2865-2866) from Mycobacterium tuberculosis. To be Published
    Site ISFI
    PDB Id 3g5o Target Id ISFI121
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS28086, Molecular Weight 10236.32 Da.
    Residues 87 Isoelectric Point 11.02
    Sequence mpytvrftttarrdlhklpprilaavvefafgdlsreplrvgkplrrelagtfsarrgtyrllyridde httvvilrvdhradiyrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.24553
    Matthews' coefficent 2.71 Rfactor 0.20247
    Waters 173 Solvent Content 54.53

    Ligand Information
    Ligands SCN (THIOCYANATE) x 1;GOL (GLYCEROL) x 1;IMD (IMIDAZOLE) x 1;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch