The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Tm1679, A METAL-DEPENDENT HYDROLASE OF THE BETA-LACTAMASE SUPERFAMILY. To be Published
    Site ISFI
    PDB Id 3h3e Target Id ISFI337
    Molecular Characteristics
    Alias Ids TPS28094, Molecular Weight 28677.36 Da.
    Residues 255 Isoelectric Point 5.95
    Sequence mrihvlcddssqngfesehgfsvlvdsvlfdtgksdvflknarklgidlpkdvlishghydhaggllyl sgkrvwlrkealdqkysgeryagadwnevlkkntgkfvieriteigknmfllgpanlrgkvptgdffve rngerrkdlfedeqtlvvrtkeglvvitgcshrgidnilldiaetfnerikmvvggfhllkssddeiek ivkafnelgvetvvpchctgeravdifkreflgkimdcyaglklevsd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.75 Rfree 0.207
    Matthews' coefficent 3.14 Rfactor 0.151
    Waters 89 Solvent Content 60.86

    Ligand Information
    Metals ZN (ZINC) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch