.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xxm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The modular architecture of protein-protein binding interfaces. Proc.Natl.Acad.Sci.USA 102 57-62 2005
    Site ISPC
    PDB Id 1xxm Target Id W00178
    Molecular Characteristics
    Source Streptomyces calvalugarus
    Alias Ids TPS11909,P35804, P00810 Molecular Weight 17316.33 Da.
    Residues 165 Isoelectric Point 5.46
    Sequence agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgftsaaadakvds ksqeallapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypaypstagvtlslscfdvdgys stgaargsahlwftdgvlqgkrqwdlv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.247
    Matthews' coefficent 2.30 Rfactor 0.219
    Waters 417 Solvent Content 46.50

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch