The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-dimensional structure of a halotolerant algal carbonic anhydrase predicts halotolerance of a mammalian homolog. Proc.Natl.Acad.Sci.Usa 102 7493-7498 2005
    Site ISPC
    PDB Id 1y7w Target Id W00565
    Molecular Characteristics
    Source Green alga dunaliella salina
    Alias Ids TPS11918, Molecular Weight 31675.61 Da.
    Residues 291 Isoelectric Point 4.74
    Sequence masmtggqqmgrgseepnpndgydymqhgfdwpglqeggttkypacsgsnqspidintnqlmepssrsg tsavslnglnvdgaqadgitltnakvdleqgmkvtfdqpaanlptieiggttksfvpiqfhfhhflseh tingihyplelhivmqeqdpadvataqlavigimykysengdaflnslqtqiegkigdgtasygdtgvs idninvktqllpsslkyagydgslttpgcdervkwhvfttprevtreqmklfvdvtmgahagadvvnnr miqdlgdrevykyny
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.86 Rfree 0.202
    Matthews' coefficent 2.65 Rfactor 0.167
    Waters 527 Solvent Content 52.70

    Ligand Information
    Ligands ACY (ACETIC) x 2
    Metals NA (SODIUM) x 2;ZN (ZINC) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch