.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b5r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Binding Hot Spots in the TEM1-BLIP Interface in Light of its Modular Architecture. J.Mol.Biol. 102 57-62 2006
    Site ISPC
    PDB Id 2b5r Target Id W00364
    Molecular Characteristics
    Source Streptomyces calvalugarus
    Alias Ids TPS11914,P35804, P00810 Molecular Weight 17316.33 Da.
    Residues 165 Isoelectric Point 5.46
    Sequence agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgftsaaadakvds ksqeallapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypaypstagvtlslscfdvdgys stgaargsahlwftdgvlqgkrqwdlv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.222
    Matthews' coefficent 2.27 Rfactor 0.19
    Waters 525 Solvent Content 46.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch