.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b83

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A single proline substitution is critical for the thermostabilization of Clostridium beijerinckii alcohol dehydrogenase. Proteins 66 196-204 2006
    Site ISPC
    PDB Id 2b83 Target Id W00283
    Molecular Characteristics
    Source Bacteria
    Alias Ids TPS11913,P25984 Molecular Weight 69424.90 Da.
    Residues 651 Isoelectric Point 6.19
    Sequence mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilgheavgevvevg sevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvfgeyfhvndadmnlailpk dmplenavmitdmmtsgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgsrpicveaa kfygatdilnyknghivdqvmkltngegvdrvimagggsetlsqavsmvkpggiisninyhgsgdalli prvewgcgmahktikgglcpggrlmkgfamlginklgwiekerpvagsydaivrplavspctsdihtvf egalgdrknmilgheavgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsn fkdgvfgeyfhvndadmnlailpkdmplenavmitdmmtsgfhgaeladiqmgssvvvigigavglmgi agaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngegvdrvimagggsetlsqa vsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrlraemlrdmvvynrvdlsklvt hvyhgfdhieealllmkdkpkdlikavvil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.25 Rfree 0.23
    Matthews' coefficent 2.60 Rfactor 0.193
    Waters 524 Solvent Content 52.60

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch