.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f1o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of NAD(P)H quinone oxidoreductase 1 in complex with its potent inhibitor dicoumarol. Biochemistry 45 6372-6378 2006
    Site ISPC
    PDB Id 2f1o Target Id W00027
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS11917,NM_000903 Molecular Weight 30866.04 Da.
    Residues 274 Isoelectric Point 8.91
    Sequence mvgrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdpanfqyp aesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfigefaytyaamydkgpf rskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfqvlepqltysightpadariqileg wkkrleniwdetplyfapsslfdlnfqagflmkkevqdeeknkkfglsvghhlgksiptdnqikark
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.75 Rfree 0.282
    Matthews' coefficent 2.55 Rfactor 0.219
    Waters 122 Solvent Content 51.71

    Ligand Information
    Ligands DTC (BISHYDROXY[2H-1-BENZOPYRAN-2-ONE,1,2-BENZOPYRONE]) x 8;FAD (FLAVIN-ADENINE) x 8
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch