The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 1041
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS84026,CE00423 Molecular Weight 13000.81 Da.
    Residues 119 Isoelectric Point 4.26
    Sequence fgkqskptpnfakksdaysadddrvpnlvdddeeeiigdeeddvnqpgpsgsqsnpepqdeeenaeqqs anssqssaaeeeddehvvpenepvkpteefakkspkntggakrrtarrgd
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch