.
The Open Protein Structure Annotation Network
PDB Keyword
.

119

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 119
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS84322,CE00129 Molecular Weight 19394.89 Da.
    Residues 170 Isoelectric Point 9.30
    Sequence maarfargfvnrnprnnelmgrqapntgyqfekdraarsyiykvelvegkshregrlvhyqdgvvisas tkepsiasqlysktdtsaalnigrvlalrclqsgihfampgatkeaieksqhqthffkaleeegltlke pahvehsyetdktftwkrypqkptrqdkldel
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch