.
The Open Protein Structure Annotation Network
PDB Keyword
.

1233

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 1233
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS84420,CE15062 Molecular Weight 58920.20 Da.
    Residues 542 Isoelectric Point 3.35
    Sequence msvddtigvvleeldsvelvmsvddtigvvleelnsvelvmsvedtigvvleeldsvelvmsvddtigv vleelnsvelvisvedtigvlleeldsvelvmsvedtigvvreklnsvelvmsvedtigvaleelnsve lvmsvedtigvvrekldsvelvmsvedtigvvrekldsvelvmsvediigvvleeldsvelvrsvedti gvvleeldsvelvmsvedtigvvrekldsvelvmsvedtigvvrekldsvelvmsvedtigvvleelns velvmsvedtigvvlekldsvelvmsvedtigvvrekldsvelvmsvediigvvleeldsvelvmsved iigvvleeldsvelvmsvedtigvvleeldsvelvmsvedtigvvleelnsvelvmsvedtigvvleel nsvelvmsvedtigvvleeldsvelvmsveytigvlleeldsvelvmsvedtigvvleeldsvelvmsv eytigvlleeldsvelvmpvvdtigvvtglgtencdvvensfevlpdlwffmsnmgenv
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch