The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 194
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS85044,CE10848 Molecular Weight 16202.52 Da.
    Residues 148 Isoelectric Point 9.24
    Sequence matavvqrkgydnvelslsedddpvkekkkskgnekkssteskskesketskeedlaqkkflmtqktqs mtedekevkpkapesqkpkknsaeesnekikkegsvkvetvaskvkpassrvppiastpgkgsvdgeqk kkstgcciil
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch