.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o59

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of an allantoicase (YIR029W) from Saccharomyces cerevisiae at 2.4 A resolution. Proteins 56 619-624 2004
    Site JCSG
    PDB Id 1o59 Target Id 355059
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS1346,YIR029W Molecular Weight 38711.81 Da.
    Residues 343 Isoelectric Point 5.93
    Sequence mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdptrfvhsgawyd gwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealydegeegniveddsrwveiv ekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrlygrvvppelktkdhiidlayvcngava lkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlgressfiekiivdtahfrgnfpqf itvegclkesessentgegtwvelvgksktgpdkehvyeirksirvshvkltiipdggvkrirvwgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.22238
    Matthews' coefficent 2.87 Rfactor 0.17542
    Waters 218 Solvent Content 56.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1o59
    1. Crystal structure of an allantoicase (YIR029W) from Saccharomyces cerevisiae at 2.4 resolution
    Q Xu, R Schwarzenbacher, R Page - Proteins: Structure, , 2004 - Wiley Online Library
     

    Protein Summary

    The YIR029W from S. cerevisiae encodes  allantoicase (EC 3.5.3.4; COG4266), that converts allantoate to urea and ureidoglycolate in the second step of allantoin degradation.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch