.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vjl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title On the use of DXMS to produce more crystallizable proteins: structures of the T. maritima proteins TM0160 and TM1171. Protein Sci. 13 3187-3199 2004
    Site JCSG
    PDB Id 1vjl Target Id 282040
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1186,TM0160, 89344 Molecular Weight 20550.23 Da.
    Residues 181 Isoelectric Point 4.52
    Sequence mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthdlllsvlesle arvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiilavktgapifvsdnlvekhs ielevnetqdeeeefkkfvenlnidtfkqmiekkreedeeges
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.253
    Matthews' coefficent 2.45 Rfactor 0.198
    Waters 164 Solvent Content 49.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vjl
    1. On the use of DXMS to produce more crystallizable proteins: structures of the T. maritima proteins TM0160 and TM1171
    G Spraggon, D Pantazatos, HE Klock, IA Wilson - Protein , 2004 - Wiley Online Library
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Prediction of active sites for protein structures from computed chemical properties
    J Ko, LF Murga, Y Wei, MJ Ondrechen - Bioinformatics, 2005 - Oxford Univ Press
     
    4. Discovery of a thermophilic protein complex stabilized by topologically interlinked chains
    DR Boutz, D Cascio, J Whitelegge, LJ Perry - Journal of molecular , 2007 - Elsevier
     
    5. A segment of cold shock protein directs the folding of a combinatorial protein
    S De Bono, L Riechmann, E Girard - Proceedings of the , 2005 - National Acad Sciences
     

    Protein Summary

    The TM0160 gene ( PF02577, cl00553) from Thermotoga maritima MSB8 encodes for the NP_227975 protein of unknown function (DUF151). Hits detected by HHpred and FFAS are not reliable enough to derive a meaningful annotation. Analysis of its genome context shows (score 0.87) the presence of a geranyltrans-transferase (TM0161).

    1vjl is the first structure of this family to be experimentally determined and revealed a novel fold (SCOP alpha+beta class, TM0160 fold). DALI only very weak hit (Z=4) is with the NE1496 protein 2fbl. This family has been brought into connection with the DNA damage recognition domain DVR [Ref]. PDB structure 1VJL replaced 1O5Y. PDB structure 1VJL contains the sequence of 1SJ5.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch