The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 1vkz Target Id 359807
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1438,TM1250, 396395 Molecular Weight 44323.56 Da.
    Residues 400 Isoelectric Point 6.11
    Sequence mkavrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpyegektlkaipeedivipgseef lvegvsnwrsnvfgpvkevarlegskvyakrfmkkygirtarfevaetpeelrekikkfsppyvikadg largkgvlildskeetiekgskliigelikgvkgpvvideflagnelsamavvngrnfvilpfvrdykr lmdgdrgpntggmgswgpveipsdtikkieelfdktlwgvekegyayrgflylglmlhdgdpyileynv rlgdpetevivtlnpegfvnavlegyrggkmepveprgfavdvvlaargypdapekgkeitlpeeglif fagvaekdgklvtnggrvlhcmgtgetkeearrkayelaekvhfegktyrrdial
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.26383
    Matthews' coefficent 2.29 Rfactor 0.21315
    Waters 121 Solvent Content 46.21


    Reactions found in Metabolic Reconstruction for TM1250

    Name: phosphoribosylglycinamide synthetase
    Metabolic Subsystem: Purine Biosynthesis
    Reaction: : atp + gly + pram --> adp + gar + h + pi
    Classification: EC:

    Ligand Information


    Google Scholar output for 1vkz
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
    2. Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
    G Sampei, S Baba, M Kanagawa, H Yanai - Journal of , 2010 - Jpn Biochemical Soc
    3. P. MS. 12P. MS. 93
    II Mathews, T Fleischmann, A Kohen - Foundations of , 2011 - scripts.iucr.org

    Protein Summary

    The gene TM1250 from Thermotoga maritima encodes phosphoribosylamine-glycine ligase PF01071 COG0151. Alternative names: GAR synthetase, glycinamide ribonucleotide synthetase, phosphoribosylglycinamide synthetase. The enzyme belongs to the class of alpha and beta (a+b) proteins and reveals PreATP-grasp domain fold type SCOP52439. The enzyme participates in purine biosynthesis. The structure of the same enzyme from several other organisms has been determined, for example Geobacillus kaustophilus 2YRW. For a discussion of the structure see [Ref].

    Ligand Summary





    1. (No Results)


      Discuss this publication

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch