The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of UDP-N-acetylglucosamine pyrophosphorylase (Agx2) from Mus musculus at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 1vm8 Target Id 354660
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS1338,16741099, 289376, 282753, 289401, 289429, 281893 Molecular Weight 58605.82 Da.
    Residues 522 Isoelectric Point 6.04
    Sequence mnvndlkqrlsqagqehllqfwnelseaqqvelymelqamnfeelnsffrkaigefdrsshqekvdarm epvprqvlgsatrdqeqlqaweseglsqisqnkvavlllaggqgtrlgvsypkgmydvglpshktlfqi qaerilklqqlaekhhgnkctipwyimtsgrtmestkefftkhkffglkkenvvffqqgmlpamsfdgk iileeknkvsmapdgngglyralaaqnivedmeqrgicsihvycvdnilvkvadprfigfciqkgadcg akvvektnptepvgvvcrvdgvyqvveyseislataqrrssdgrllfnagnianhfftvpflkdvvnvy epqlqhhvaqkkipyvdsqgyfikpdkpngikmekfvfdifqfakkfvvyevlredefsplknadsqng kdnpttarhalmslhhcwvlnagghfidengsrlpaiprsatngkseaitadvnhnlkdandvpiqcei splisyageglegyvadkefhapliidengvhelvkngi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.26573
    Matthews' coefficent 2.90 Rfactor 0.20676
    Waters 122 Solvent Content 57.25

    Ligand Information


    Google Scholar output for 1vm8
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. FLORA: a novel method to predict protein function from structure in diverse superfamilies
    OC Redfern, BH Dessailly, TJ Dallman - PLoS computational , 2009 - dx.plos.org
    3. Crystal structure of uridine-diphospho-N-acetylglucosamine pyrophosphorylase from Candida albicans and catalytic reaction mechanism
    D Maruyama, Y Nishitani, T Nonaka, A Kita - Journal of Biological , 2007 - ASBMB
    4. Homology modelling of pyrophosphosrylase, enzyme involved in chitin pathway of Moniliophthora perniciosa
    MC Dos Santos Jr, AG Taranto, SA De Assis - International Journal of , 2009 - Inderscience
    5. Purification, characterization and structural determination of UDP-N-acetylglucosamine pyrophosphorylase produced by Moniliophthora perniciosa
    MC Santos Junior, PA Gonalves - Journal of the Brazilian , 2011 - SciELO Brasil
    6. Applications of Structural Bioinformatics for the Structural Genomics Era
    M Novotny - 2007 - uu.diva-portal.org

    Protein Summary

    The gene 16741099 from  Mus musculus encodes an enzyme UDP-N-acetylglucosamine diphosphorylase (alternative names: N-acetylglucosamine-1-phosphate uridyltransferase, UDP-N-acetylglucosamine pyrophosphorylase) EC:  The enzyme catalyzes the nucleotidyl group transfer reaction: UTP + N-acetyl-alpha-D-glucosamine-1-phosphate = diphosphate + UDP-N-acetyl-D-glucosamine.  This enzyme belongs to the family of transferases, specifically those transferring phosphorus-containing nucleotide groups (nucleotidyltransferases) PF01704.  This enzyme is a part of UDP-N-acetylglucosamine biosynthesis pathway.  The protein belongs to the class of alpha and beta proteins (a+b) and reveals nucleotide-diphospho-sugar transferases fold type SCOP53447.  To date multiple structures of the enzyme homologues from different organisms have been determined: 1JV1, human; 2YQCCandida albicans.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch