.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vr6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase) (TM0343) from Thermotoga Maritima at 1.92 A resolution. To be published
    Site JCSG
    PDB Id 1vr6 Target Id 282218
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1201,TM0343, 282169 Molecular Weight 37376.12 Da.
    Residues 338 Isoelectric Point 6.22
    Sequence mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcvesvvrvlkpy klvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflselgvkvlrggaykprtspys fqglgekgleylreaadkygmyvvtealgeddlpkvaeyadiiqigarnaqnfrllskagsynkpvllk rgfmntieefllsaeyiansgntkiilcergirtfekatrntldisavpiirkeshlpilvdpshsggr rdlviplsraaiavgahgiivevhpepekalsdgkqsldfelfkelvqemkkladalgvkvn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.92 Rfree 0.21519
    Matthews' coefficent 2.20 Rfactor 0.17089
    Waters 615 Solvent Content 43.59

    Pathway

    Reactions found in Metabolic Reconstruction for TM0343

    Name: 3-deoxy-D-arabino-heptulosonate 7-phosphate synthetase
    Metabolic Subsystem: Chorismate Biosynthesis
    Reaction: : e4p + h2o + pep --> 2dda7p + pi
    Classification: EC:4.1.2.15
     

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vr6
    1. His-tag impact on structure
    M Carson, DH Johnson, H McDonald - Section D: Biological , 2007 - scripts.iucr.org
     
    2. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
     
    3. Tyrosine latching of a regulatory gate affords allosteric control of aromatic amino acid biosynthesis
    PJ Cross, RCJ Dobson, ML Patchett - Journal of Biological , 2011 - ASBMB
     
    4. An insilico approach to structural elucidation of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from Arabidopsis thaliana: Hints for herbicide design
    S Bhattacharya, P Kumar - Phytochemistry, 2011 - Elsevier
     

    Protein Summary

    The TM0343 gene from Thermotoga maritima encodes a phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase) (PF00793, COG2876, EC 2.5.1.54 ). The structure folds into a TIM beta/alpha barrel  and is essentially identical to the DAHP synthase from another hyperthermophile, Pyrococcus furiosus (PDB id: 1zco) with a main-chain rmsd ov 0.98 Å over 252 residues and a sequence identity of 62%. For more details on the structure, binding site and catalytic mechanism, see Shofield 2005.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch