.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zkg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of TM1030 from Thermotoga maritima at 2.3 A resolution reveals molecular details of its transcription repressor function. Proteins 68 418-424 2007
    Site JCSG
    PDB Id 1zkg Target Id 282897
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1254,TM1030, 84786 Molecular Weight 23799.48 Da.
    Residues 200 Isoelectric Point 6.25
    Sequence mlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvteklqkefenf lmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvreklkd ldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilkkgmtk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.264
    Matthews' coefficent 2.60 Rfactor 0.201
    Waters 56 Solvent Content 52.25

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zkg
    1. Regulation of the Dha Operon of Lactococcus lactis
    S Christen, A Srinivas, P Bhler, A Zeller - Journal of Biological , 2006 - ASBMB
     
    2. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    3. Crystal structure of a transcriptional regulator TM1030 from Thermotoga maritima solved by an unusual MAD experiment
    KD Koclega, M Chruszcz, MD Zimmerman - Journal of structural , 2007 - Elsevier
     
    4. Crystal structure of TM1030 from Thermotoga maritima at 2.3 resolution reveals molecular details of its transcription repressor function
    L Premkumar, CL Rife, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    5. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary

    TM1030 is a TetR like transcription repressor. The  structure presented here describes the ligand-bound form of TM1030[Ref]. MCSG, independently determined the  structure of apo-TM1030[Ref]. A structure superposition of apo and ligand bound forms, reveals a dramatic conformational change upon ligand binding.

     

    Ligand Summary

    There are two UNLs present within the ligand binding pocket of each TM1030 monomer. Based on the shape of the electron density, it is likely a heptaethelene glycol.

    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch