The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of alpha-galactosidase (ec (melibiase) (tm1192) from Thermotoga maritima at 2.34 A resolution. to be published
    Site JCSG
    PDB Id 1zy9 Target Id 359818
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1439,TM1192, 396418 Molecular Weight 63653.26 Da.
    Residues 552 Isoelectric Point 5.22
    Sequence meifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkapekvlvnnwqswgpcr vvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvygflsskiahpffavedgelvayley fdvefddfvpleplvvledpntplllekyaelvgmennarvpkhtptgwcswyhyfldltweetlknlk laknfpfevfqiddayekdigdwlvtrgdfpsveemakviaengfipgiwtapfsvsetsdvfnehpdw vvkengepkmayrnwnkkiyaldlskdevlnwlfdlfsslrkmgyryfkidflfagavpgerkknitpi qafrkgietirkavgedsfilgcgspllpavgcvdgmrigpdtapfwgehiedngapaarwalrnaitr yfmhdrfwlndpdclilreektdltqkekelysytcgvldnmiiesddlslvrdhgkkvlketlellgg rprvqnimsedlryeivssgtlsgnvkivvdlnsreyhlekegksslkkrvvkredgrnfyfyeegere
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.34 Rfree 0.213
    Matthews' coefficent 3.40 Rfactor 0.162
    Waters 244 Solvent Content 63.58


    Reactions found in Metabolic Reconstruction for TM1192

    Name: hydrolysis of galactomannan
    Other genes that carryout this rxn:TM1751 TM1624 TM1752
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : galman6 + h2o --> gal + man
    Classification: EC:
    Name: hydrolysis of galactomannan
    Other genes that carryout this rxn:TM1751 TM1624 TM1752
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : galman4 + h2o --> gal + man
    Classification: EC:
    Name: a-galactosidase (melibiose)
    Metabolic Subsystem: Raffinose Metabolism
    Reaction: : h2o + melib --> gal + glc-D
    Classification: EC:

    Ligand Information


    Google Scholar output for 1zy9
    1. How the walls come crumbling down: recent structural biochemistry of plant polysaccharide degradation
    HJ Gilbert, H Stlbrand, H Brumer - Current opinion in plant biology, 2008 - Elsevier
    2. Structure of the Sulfolobus solfataricus [alpha]-Glucosidase: Implications for Domain Conservation and Substrate Recognition in GH31
    HA Ernst, L Lo Leggio, M Willemos, G Leonard - Journal of molecular , 2006 - Elsevier
    3. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
    4. Biochemical Analysis of Thermotoga maritima GH36 _-Galactosidase (Tm GalA) Confirms the Mechanistic Commonality of Clan GH-D Glycoside Hydrolases
    A Donald, KS Bobrov, DR Ivanen, KA Shabalin - Biochemistry, 2007 - ACS Publications
    5. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    6. A unified statistical model to support local sequence order independent similarity searching for ligand-binding sites and its application to genome-based drug
    L Xie, L Xie, PE Bourne - Bioinformatics, 2009 - Oxford Univ Press
    7. Plant glycosyl hydrolases and biofuels: a natural marriage
    G Lopez-Casado, BR Urbanowicz - Current opinion in plant , 2008 - Elsevier
    8. Structural and functional analysis of a glycoside hydrolase family 97 enzyme from Bacteroides thetaiotaomicron
    M Kitamura, M Okuyama, F Tanzawa, H Mori - Journal of Biological , 2008 - ASBMB
    9. Divergence of catalytic mechanism within a glycosidase family provides insight into evolution of carbohydrate metabolism by human gut flora
    TM Gloster, JP Turkenburg, JR Potts, B Henrissat - Chemistry & biology, 2008 - Elsevier
    10. A general, robust method for the quality control of intact proteins using LC-ESI-MS
    G Sundqvist, M Stenvall, H Berglund, J Ottosson - of Chromatography B, 2007 - Elsevier
    11. Volsurf computational method applied to the prediction of stability of thermostable enzymes
    P Braiuca, A Buthe, C Ebert, P Linda - Biotechnology , 2007 - Wiley Online Library
    12. A novel _-D-galactosynthase from Thermotoga maritima converts _-D-galactopyranosyl azide to _-galacto-oligosaccharides
    B Cobucci-Ponzano, C Zorzetti, A Strazzulli - , 2011 - Soc Glycobiology
    13. Aspergillus nidulans__galactosidase of glycoside hydrolase family 36 catalyses the formation of __galacto_oligosaccharides by transglycosylation
    H Nakai, MJ Baumann, BO Petersen, Y Westphal - FEBS , 2010 - Wiley Online Library
    14. Crystal structure of [alpha]-galactosidase from Lactobacillus acidophilus NCFM: insight into tetramer formation and substrate binding
    F Fredslund, MA Hachem, RJ Larsen - Journal of molecular , 2011 - Elsevier
    15. Crystallization and preliminary X-ray diffraction data of-galactosidase from Saccharomyces cerevisiae
    R Fernndez-Leiro, A Pereira-Rodriguez - Section F: Structural , 2009 - scripts.iucr.org
    16. Crystallization and preliminary X-ray diffraction studies of two thermostable-galactosidases from glycoside hydrolase family 36
    M Foucault, H Watzlawick, R Mattes - Section F: Structural , 2006 - scripts.iucr.org
    17. _-Galactosidase/Sucrose Kinase (AgaSK), a Novel Bifunctional Enzyme from the Human Microbiome Coupling Galactosidase and Kinase Activities
    L Bruel, G Sulzenbacher, MC Tison, A Pujol - Journal of Biological , 2011 - ASBMB
    18. Thermophilic Glycosynthases for Oligosaccharides Synthesis
    B Cobucci-Ponzano, G Perugino, A Strazzulli - Cellulases, 2012 - books.google.com

    Protein Summary

    The gene TM1192 from Thermotoga maritima encodes a alpha-galactosidase (specifically alpha-1,6-galactosidase) COG3345, a member of melibiases family PF02065.  The enzyme contains a domain adopting a  supersandwich fold type SCOP49993.  The enzyme is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. It predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose.  In humans (3HG3 3HG4),  a variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry's disease, a rare lysosomal storage disorder and sphingolipidosis that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch