.
The Open Protein Structure Annotation Network
PDB Keyword
.

232369

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 232369
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS85440,CE03232 Molecular Weight 34004.77 Da.
    Residues 294 Isoelectric Point 9.11
    Sequence mdkisniynfddpppdklslelfiiekkigkgqfsevfraqctwvdlhvalkkiqvfemvdqkarqdcl keidllkqlnhvnviryyasfidnnqlnivlelaeagdmsrmikhfkkggrlipektiwkyfvqlaral ahmhskrimhrdikpanvfitgngivklgdlglgrffsskttaahslvgtpyymsperiqesgynfksd lwstgcllyemaalqspfygdkmnlyslckkienceypplpadiystqvsanlcfvqlssatwypvvyf qklqndqrpvkfyrfvpr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch