.
The Open Protein Structure Annotation Network
PDB Keyword
.

232432

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 232432
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS85567,CE10626 Molecular Weight 40857.69 Da.
    Residues 364 Isoelectric Point 8.44
    Sequence meaiatrnknstleqkkkdpeitessknssqpsqvpaatptaappskahqkamivvkpwvqrtldmgvq alvdefrvlakwtpegmtteafsantdknryqdvpcqdkgrivvkfpglasdyihanylgtatnpkkfi caqgplentqhsfwamaiqekvecvimlcncietgkikchqywpleqgqklvfgeapntisvanlgakk mapdeqcinvttlkvdwgqgsrtiqhlqwenwpdrgvpqtnltainllsatrgnqnpilvhcsagigrt gtivaiayvqdkmmagencmamnelikelrshrpwsiqnefqylylhrvllsyfleryketyaellvgd ygekykkwaddyaaatatk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch