.
The Open Protein Structure Annotation Network
PDB Keyword
.

245

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 245
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS86145,CE06005 Molecular Weight 23087.96 Da.
    Residues 214 Isoelectric Point 6.03
    Sequence mkllvstlilisavsavrngidfiqpvsvatftcvknagysfviprvftsvgtvdhtgiqnvanaraag ltdvdgyifpclkstcasaanqvkasldavkaagtkistlwldierlnwpadhasnrafieamvseaka ygqqvgiysnyynwqdivgldyhgqsslmlwwaaydgvkdfskfaafggwssptihqwegttagpcgvs vdmnyvp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch