.
The Open Protein Structure Annotation Network
PDB Keyword
.

281905

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281905
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18743,TM0024, 83897 Molecular Weight 72536.56 Da.
    Residues 642 Isoelectric Point 4.22
    Sequence mmsrlvfalllfpvfilaqnilgnasfdepiliagvdidppaedgsidtggnwvfftnsngegtarven gvlvveitnggdhtwsvqiiqapirveklhkyrvsfrakassqknigvkiggtagrgwtaynpgtdesg gmvfelgtdwqkyefefvmrqetdenarfefqlgrytgtvwiddvvmedigvlevsgeeneiyteeded kvedwqlvwsqefddgvidpniwnfeignghakgipgwgngeleyytdenafvengclviearkeqvsd eygtydytsarmttegkfeikygkieiraklpkgkgiwpalwmlgnnigevgwptcgeidimemlghdt rtvygtahgpgysggasigvayhlpegvpdfsedfhifsiewdedevewyvdgqlyhvlskdelaelgl ewvfdhpfflilnvavggywpgypdettqfpqrmyidyirvykdmnpetitgevddceyeqaqqqagpe vtyeqinngtfdepivndqannpdewfiwqagdygisgarvsdygvrdgyayitiadpgtdtwhiqfnq wiglyrgktytisfkakadtprpinvkilqnhdpwtnyfaqtvnltadwqtftftythpddadevvqis felgegtattiyfddvtvspq
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0024

    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn: TM1524 TM0025 TM0076
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan6 + h2o --> glc-D

     
    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn:TM1524 TM0025 TM0076
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan4 + h2o --> glc-D

     
    Name: Laminarinase (extracellular)
    Metabolic Subsystem: Laminarine Metabolism
    Reaction: : h2o + lmn30 --> lmn2

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0024
    generated 12/2008
    Transmembrane protein

    HMM_TM0024

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch