.
The Open Protein Structure Annotation Network
PDB Keyword
.

281906

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281906
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18744,TM0025 Molecular Weight 81069.84 Da.
    Residues 721 Isoelectric Point 5.11
    Sequence merideilsqltteekvklvvgvglpglfgnphsrvagaagethpvprlgipafvladgpaglrinptr endentyyttafpveimlastwnrdlleevgkamgeevreygvdvllapamnihrnplcgrnfeyysed pvlsgemasafvkgvqsqgvgacikhfvannqetnrmvvdtivseralreiylkgfeiavkkarpwtvm saynklngkycsqnewllkkvlreewgfdgfvmsdwyagdnpveqlkagndmimpgkayqvnterrdei eeimealkegklseevldecvrnilkvlvnapsfkgyrysnkpdleshaevayeagaegvvllenngvl pfdenthvavfgtgqietikggtgsgdthprytisilegikernmkfdeelastyeeyikkmreteeyk prtdswgtvikpklpenflsekeikkaakkndvavvvisrisgegydrkpvkgdfylsddeleliktvs kefhdqgkkvvvllnigspievaswrdlvdgillvwqagqemgrivadvlvgkinpsgklpttfpkdys dvpswtfpgepkdnpqrvvyeediyvgyryydtfgvepayefgyglsytkfeykdlkiaidgetlrvsy titntgdragkevsqvyikapkgkidkpfqelkafhktkllnpgeseeisleiplrdlasfdgkewvve sgeyevrvgassrdirlrdiflvegekrfkp
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0025

    Name: beta-glucosidase
    Other genes that carryout this rxn: TM0076
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : cellb + h2o --> glc-D
    Classification: EC:3.2.1.21
     
    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn:TM0024 TM1524 TM0076
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan6 + h2o --> glc-D

     
    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn:TM1524 TM0076 TM0024
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan4 + h2o --> glc-D

     
    Name: laminaribiase
    Other genes that carryout this rxn: TM0076
    Metabolic Subsystem: Laminarine Metabolism
    Reaction: : h2o + lmn2 --> glc-D

     
    Name: exo-xylosidase
    Other genes that carryout this rxn: TM0076
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : h2o + xylb <==> xyl-D

     
    Name: exo-xylosidase
    Other genes that carryout this rxn: TM0076
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : h2o + xyl3 <==> xyl-D

     
    Name: exo-xylosidase
    Other genes that carryout this rxn: TM0076
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : h2o + xyl4 <==> xyl-D

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0025
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch