.
The Open Protein Structure Annotation Network
PDB Keyword
.

281908

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281908
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18745,TM0027, BV1071, RER070207000405, 83912 Molecular Weight 30619.07 Da.
    Residues 268 Isoelectric Point 9.07
    Sequence msrlvvknltkifslgffskrrieavknvsfevkekeivslvgesgsgktttakmilrllpptsgeiyf egkdiwkdikdreslvefrrkvhavfqdpfasynpfypvertlwqaisllenkpsnkkealelikeslf rvgidpkdvlgkyphqisggqkqrimiarcwilrpllivadeptsmidassrggiiklleelreeqgts iifithdlglayyvsdnifvmkngeiverghpdkvvleptheytkllvgsipklyrkledl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0027

    Name: Cellobiose transport via ATP transporter
    Other genes that carryout this rxn:TM0028 TM0030 TM0029 TM0031 TM1221 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + cellb[e] + h2o[c] --> adp[c] + cellb[c] + h[c] + pi[c]

     
    Name: Laminoribiose transport via ABC-transporter
    Other genes that carryout this rxn:TM0028 TM0030 TM0029 TM0031 TM1204 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + lmn2[e] --> adp[c] + h[c] + lmn2[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0027
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch