.
The Open Protein Structure Annotation Network
PDB Keyword
.

281909

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 281909
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1947,TM0028, _0000.000321_, _0000.000765_, BV1071, 83919 Molecular Weight 37302.96 Da.
    Residues 330 Isoelectric Point 8.17
    Sequence mkeillkaenvrayyklekvsvkavdglsfeiledevigvvgesgcgkttlsnvifmnmvkpltlvdgk iflrvngefvelssmtrdevkrkfwgkeitiipqaamnalmptirmekyvrhlaeshgideeelldkar rrfeevgldplwikrypfelsggmrqraviaiatilnpslliadeptsaldvvnqkvllkvlmqmkrqg ivksiifithdiatvrqiadrmiimyagkivefapvesllekplhpytqglfnsvltpepevkkrgitt ipgappnlinppsgcrfhprcphamdvckekepplteiepgrrvacwlymeera
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0028

    Name: Cellobiose transport via ATP transporter
    Other genes that carryout this rxn: TM0030 TM0029 TM0027 TM0031 TM1221 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + cellb[e] + h2o[c] --> adp[c] + cellb[c] + h[c] + pi[c]

     
    Name: Laminoribiose transport via ABC-transporter
    Other genes that carryout this rxn: TM0030 TM0029 TM0027 TM0031 TM1204 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + lmn2[e] --> adp[c] + h[c] + lmn2[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0028
    generated 12/2008

    Protein Summary

     

    Ligand Summary

     

    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch