.
The Open Protein Structure Annotation Network
PDB Keyword
.

281910

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281910
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18746,TM0029, 382439 Molecular Weight 31204.48 Da.
    Residues 280 Isoelectric Point 7.95
    Sequence mfrtmirplfknkkfiigfsiflfflflgifgpmfyrvdptemtwdyeqppssahplgtdtygrdvlaq llhgirsslyigflaaiislvigtiigsfsavkrgivddvlmgitnivlttpsiliailiasylkvrsv emvavilglfqwpwfarairaqlmsvmsreyvylsvmagysdlrlviedliptiatyafmsfvlfingg imgeaglsliglgptqgislgimlqwavlmeavrrglwwwfvppglaivavtasllvistamdevfnpr lree
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0029

    Name: Cellobiose transport via ATP transporter
    Other genes that carryout this rxn:TM0028 TM0030 TM0027 TM0031 TM1221 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + cellb[e] + h2o[c] --> adp[c] + cellb[c] + h[c] + pi[c]

     
    Name: Laminoribiose transport via ABC-transporter
    Other genes that carryout this rxn:TM0028 TM0030 TM0027 TM0031 TM1204 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + lmn2[e] --> adp[c] + h[c] + lmn2[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0029
    generated 12/2008
    Transmembrane protein

    HMM_TM0029

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch