.
The Open Protein Structure Annotation Network
PDB Keyword
.

281922

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281922
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18750,TM0041 Molecular Weight 15092.68 Da.
    Residues 129 Isoelectric Point 5.57
    Sequence mnkrnikvekvssvietepygyedqprflnavciaqtplsphellntllqiernmgrvrtirwgpriid ldivfyedlvlseedliiphpdahnrtfvleplceiapdlihpvmgktvrelledlrrrr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0041

    Name: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
    Metabolic Subsystem: Folate Metabolism
    Reaction: : 2ahhmp + atp --> 2ahhmd + amp + h
    Classification: EC:2.7.6.3
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0041
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch