.
The Open Protein Structure Annotation Network
PDB Keyword
.

281924

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281924
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18752,TM0043, BV1071, 89335 Molecular Weight 66321.03 Da.
    Residues 581 Isoelectric Point 8.55
    Sequence milspekfllryakkywylflvgtvlsliltvmeilpprlmktaidkflvestlssferlngivitafi ilgirvlsflvgfassyvtgyagsrivllmrkdvfshvislpysfftgipsgvvttrivndtqniqeff ssvvtsvimdvlllgavvvslvqlsrelfghvyyllplivisillfryfdrrayrkvrtnlarlnafla ehiaginvtkilnlekhkerefstvateyyrslmeqlyvfgvfrplmdflyflgvslvlwygaryiank tlgfgslyafvsyldmffrplrdlsekydiiqnsmassekilnllkeepevignpngpnkiskgrvrfe nvwfsydgknwvlkdinldfqpgklyaivgetgggkstlmslinglyipqkgnifideiplleynlklv rkqiaavpqdvllfsgtildnirlfdesipeervlealkrvhaldiierlpggvyyeivergttlsage rqlialaravlfdakifildeatsnvdvitetkiqealeelskdrtvimiahrlstvkdvdeivvvhng rivekgnhyellekrgfyynlykiqfena
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0043
    generated 12/2008
    Transmembrane protein

    HMM_TM0043

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch