.
The Open Protein Structure Annotation Network
PDB Keyword
.

281932

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281932
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18755,TM0051, MCSG_3.40.50.300_ID_1464 Molecular Weight 75136.23 Da.
    Residues 669 Isoelectric Point 8.28
    Sequence mpvksltrrseisqkivkvalagcpnvgktslfnaltgtkqyvanwpgvtvekkegvftykgytinlid lpgtyslgyssidekiardyllkgdadlvilvadsvnpeqslyllleilemekkvilamtaideakktg mkidryelqkhlgipvvftssvtgegleelkekiveyaqkntilhrmildygekveseikkvenflrdk klrinpryfalkylsgdpefysegvklglpelseeerigyrlliakrkreyvenvvkeafadagsksls lseaidhvlthkflsfplffalmylvfkftfdiaqvfsdlldllfsqlgsavvntfgenaftslisdgi iggvgsvlvftpnifamflalgfleesgylpraafvmdrimekfklsgrafmslilgfgcnvpsimatr aiddprerlvtilitpfiscsarlpvyllilriffpessaamlfiiyslsilitllssvvinwlfyrgr tsplilelpryrmptlknlyiytwnrgkhflkkagtiifvsailiwvlsyfpaagdiensfsamigksl ewifkpfgyswkivtslfygavakevvvstmsmlygfeeetflgakealsaemdpvsaiaflifvmayi pcfatiatiysetgslkwtlfsigyslsiayvlslivfyvgklvvmli
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0051
    generated 12/2008
    Transmembrane protein

    HMM_TM0051

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch