.
The Open Protein Structure Annotation Network
PDB Keyword
.

281939

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 281939
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1956,TM0058, BV1071, 289552 Molecular Weight 37222.78 Da.
    Residues 331 Isoelectric Point 6.68
    Sequence mekvleirdlkvyfdltegtvkavdgvsfdirrgeilglvgesgcgksvtaqsilrilpksarivngei vfhrngktldltrldpegeeirdirgkdismifqepmasfspvytvgaqmieaillhenvskeearkrv vemlkkvkipnaekvvdmypfelsggmlqrcmiamamslnptllladepttaldvtiqaqilylmkelq keyhssillithdmgvvaqmadrvavmylgnivetaevfelfknplhpytqallrsipkigirktrlet ikgmvpdpynlptgcrfhnrcekfmkglcdvkeppevevkpghkvkcflyggeke
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0058

    Name: D-xylose transport via ABC system
    Other genes that carryout this rxn:TM0114 TM0112 TM0115 TM0060 TM0056 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xyl-D[e] --> adp[c] + h[c] + pi[c] + xyl-D[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0058
    generated 12/2008

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch