.
The Open Protein Structure Annotation Network
PDB Keyword
.

281941

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281941
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18759,TM0060, 83914 Molecular Weight 36534.35 Da.
    Residues 328 Isoelectric Point 8.61
    Sequence mlayiakrvlyaipllfvisivsfiiielppgdylttyvmtlrqsgetidqaalevlkkrygldkpviv ryfywigniitkgdfgysfmwekpvsdllnqrvwwtilisvlstafawvfgfligvysgthqysigdyv ftvlgyiglatpnfllalillwfmfvttgvslgglfspeyagapwswakfvdllkhiwipvvvlgtgsm aglirvlranlldeinkpyvvaarargvperelvwkyplrvavipfastagwalpqivsgavvtgivln lptvgtllldaltsqdmylagslvlilsvftiigtlisdillawldprirfe
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0060

    Name: D-xylose transport via ABC system
    Other genes that carryout this rxn:TM0114 TM0112 TM0115 TM0058 TM0056 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xyl-D[e] --> adp[c] + h[c] + pi[c] + xyl-D[c]

     
    Name: oligo-xylan ABC transport
    Other genes that carryout this rxn:TM0075 TM0071 TM0072 TM0074 TM0073 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xylan4[e] --> adp[c] + h[c] + pi[c] + xylan4[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0060
    generated 12/2008
    Transmembrane protein

    HMM_TM0060

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch