.
The Open Protein Structure Annotation Network
PDB Keyword
.

281942

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 281942
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26310,TM0061 Molecular Weight 119637.14 Da.
    Residues 1059 Isoelectric Point 5.02
    Sequence mqvrkrrglldvstavlvgilagflgvvlaasgvlsfgkeasskgdssletvlalsfegttegvvpfgk dvvltasqdvaadgeyslkvenrtspwdgveidltgkvksgadyllsfqvyqssdapqlfnvvartede kgerydvildkvvvsdhwkeilvpfsptfegtpakysliivaskntnfnfyldkvqvlapkesgpkviy etsfengvgdwqprgdvnieassevahsgksslfisnrqkgwqgaqinlkgilktgktyafeawvyqns gqdqtiimtmqrkyssdastqyewiksatvpsgqwvqlsgtytipagvtvedltlyfesqnptlefyvd dvkivdttsaeikiemepekeipalkevlkdyfkvgvalpskvflnpkdielitkhfnsitaenemkpe sllagiengklkfrfetadkyiqfveengmvirghtlvwhnqtpdwffkdengnllskeamterlkeyi htvvghfkgkvyawdvvneavdpnqpdglrrstwyqimgpdyielafkfareadpdaklfyndyntfep rkrdiiynlvkdlkekglidgigmqchislatdikqieeaikkfstipgieihiteldmsvyrdsssny peaprtalieqahkmmqlfeifkkysnvitnvtfwglkddyswratrrndwplifdkdhqaklaywaiv apevlpplpkesrisegeavvvgmmddsylmskpieildeegnvkatiravwkdstiyiygevqdktkk paedgvaifinpnnertpylqpddtyavlwtnwktevnredvqvkkfvgpgfrrysfemsitipgvefk kdsyigfdaaviddgkwyswsdttnsqktntmnygtlklegimvatakygtpvidgeideiwntteeie tkavamgsldknatakvrvlwdenylyvlaivkdpvlnkdnsnpweqdsveifidennhktgyyeddda qfrvnymneqtfgtggsparfktavklieggyiveaaikwktikptpntvigfniqvndanekgqrvgi iswsdptnnswrdpskfgnlrlik
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0061

    Name: xylanase (endo-acting) (extracellular)
    Other genes that carryout this rxn:TM0070
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : h2o + xylan8 --> xylan4

     
    Name: xylanase (endo-acting) (extracellular)
    Other genes that carryout this rxn: TM0070
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : h2o + xylan12 --> xylan4 + xylan8

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0061
    generated 12/2008
    Transmembrane protein

    HMM_TM0061

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch