.
The Open Protein Structure Annotation Network
PDB Keyword
.

281953

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281953
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18761,TM0072, 83962 Molecular Weight 38220.71 Da.
    Residues 335 Isoelectric Point 9.75
    Sequence msfvrryllprlityflvvfvgltivfflprflpsdpiqayidrlitqggnlnpeyfnklvetikelyg lqgslwnqyvnfwkrllkgdfgpsyfqfptpvmklirqslpwtawllfvttviswiignilgglagyfs dkkwvkildgiamvirpmpyyilalgllillayifpifpigggfaigmkftfswenllillkhaflpal slvligvfswfqamklvvqsvktedyvkyakmggveerrivrryvirnamlpqitglalslgqifggal iteivfsypgigsllynaiftgdynllmgistlsillvttsilvidllyplfdprvryr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0072

    Name: Xylotriose ABC transport
    Other genes that carryout this rxn:TM0075 TM0071 TM0074 TM0073
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xyl3[e] --> adp[c] + h[c] + pi[c] + xyl3[c]

     
    Name: Xylobiose ABC transport
    Other genes that carryout this rxn:TM0075 TM0071 TM0074 TM0073
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xylb[e] --> adp[c] + h[c] + pi[c] + xylb[c]

     
    Name: oligo-xylan ABC transport
    Other genes that carryout this rxn:TM0075 TM0071 TM0074 TM0073 TM0060 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xylan4[e] --> adp[c] + h[c] + pi[c] + xylan4[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0072
    generated 12/2008
    Transmembrane protein

    HMM_TM0072

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch