.
The Open Protein Structure Annotation Network
PDB Keyword
.

281956

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281956
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18763,TM0075, BV1071, _0000.000321_, 83892 Molecular Weight 36607.36 Da.
    Residues 320 Isoelectric Point 7.56
    Sequence mplleiknltkiftigsifsrtrivavdnvnfdineaeiftlagesgcgktttakiilgfeeptsgeii ykgrkidrvhqnekerrellkeiqavfqnpfstfnplrkvdryfyetlfnlgiadtkkkaeeiikekls avgisfeefsekypsefsggqlqrisiaralltnpsllvadepvsmvdaslrmsivnlfkdlkeqygvs vlyithdlttayyvsdriavmfrgnivelgpaekvlmepkhpytqllresvpepdpkkkwdiriklset eqaeylrqgckfagrcpkamdicrkepppyfevdgvqvkcwlyr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0075

    Name: Xylotriose ABC transport
    Other genes that carryout this rxn: TM0071 TM0072 TM0074 TM0073
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xyl3[e] --> adp[c] + h[c] + pi[c] + xyl3[c]

     
    Name: Xylobiose ABC transport
    Other genes that carryout this rxn: TM0071 TM0072 TM0074 TM0073
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xylb[e] --> adp[c] + h[c] + pi[c] + xylb[c]

     
    Name: oligo-xylan ABC transport
    Other genes that carryout this rxn: TM0071 TM0072 TM0074 TM0073 TM0060 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xylan4[e] --> adp[c] + h[c] + pi[c] + xylan4[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0075
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch