.
The Open Protein Structure Annotation Network
PDB Keyword
.

281960

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281960
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18764,TM0079, 83907 Molecular Weight 34969.97 Da.
    Residues 322 Isoelectric Point 9.67
    Sequence mrklvfpililsfllgiffgsvpldplevlgvlfglkenpgverilslriprvlasflvgaglsivgns fqnllknplvdpyllgissgasfgtvvsfylaetlgiswiyripllsfgfsmiaslltlliarkegrfp vttivlsgvvvstlfssltymtivllkrnvttismwlfgsfsgstwedvlfylmvvipfllyslifskh lnamalgeeeafilgvsverlkvvtflfgnlitaflvsrsgvigfvglivphisrylvgpnflksvlss livggvlltlcdtaartffsptelpvgvvtaligapflaflmkrgv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0079

    Name: iron (III) transport via ABC system
    Other genes that carryout this rxn:TM0080 TM0078 TM0189 TM0191 TM0190
    Metabolic Subsystem: Transport
    Reaction: atp[c] + fe3[e] + h2o[c] --> adp[c] + fe3[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0079
    generated 12/2008
    Transmembrane protein

    HMM_TM0079

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch