.
The Open Protein Structure Annotation Network
PDB Keyword
.

281972

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281972
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS33071,TM0091, 83956 Molecular Weight 21622.94 Da.
    Residues 182 Isoelectric Point 8.78
    Sequence meklniypfkkrkvklstflvllavmllppvsfniyfsyakeqmierlqsdysevlraysvklskdssk nleeisrvesvfmnqikslevrvnqlnafldkrkkwedfvkvllnifedqnrtlcyldfsqekaivefy evsknvvsstfqnsnvstsllfeeklpegfylrkyrleyeavek
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0091

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch