.
The Open Protein Structure Annotation Network
PDB Keyword
.

281986

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281986
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS33050,TM0105 Molecular Weight 34269.59 Da.
    Residues 319 Isoelectric Point 5.56
    Sequence mkilevlwnifsnplfykltltastpllfaslggvfsevtgvvnialegimllgafssvvityytgnvw lgfllsipigigfswfhawasikwrgnqivsatalilvaqgltgflmepifgqpgqtpyvgrieeitlp gissipfigeaigtispivliafamvffawfliyktplglrmrsvgenpeaadtlgvdvfkiryfgvlm sgalasmggaflsigevgnfrelmtggrgfialaamilgnwnpigamwaclmfgmsealanqlqsspil nvpatakplfnlfpfvvtlvvvagligrtrppaadgvpyekee
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0105

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch