.
The Open Protein Structure Annotation Network
PDB Keyword
.

281989

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281989
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18775,TM0108 Molecular Weight 45962.69 Da.
    Residues 421 Isoelectric Point 5.19
    Sequence mgklvvqggavlegeveisgsknaalpimaaailcdeevilknvprlqdvfvmidilrsigfrvefeen elkikrendisqevpyelvrkmrasfnvlgpiavrtgrakvalpggcsigvrpvdfhleglkkmgfsik vehgfveacferridyvtitlpfpsvgatehlmttaallkgarvvienaamepeivdlqnfinrmgghi egagtsriviegvekmqgveysiipdrieagtylvaiaasrgkglvknvnpdhltnffekleetgaklk vlgneveiemrerpkavdvttnpypgfptdlqpqmmaylstasgvsvitenvfktrflhvdelkrmgad ievsgnvaivkgveklsgapvegtdlrataalliagiiadgvteisnvehifrgyedvidkfselgaki eyveken
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0108

    Name: UDP-N-acetylglucosamine 1-carboxyvinyltransferase reversible
    Metabolic Subsystem: Peptidoglycan Biosynthesis
    Reaction: : pep + uacgam <==> pi + uaccg
    Classification: EC:2.5.1.7
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0108
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch