.
The Open Protein Structure Annotation Network
PDB Keyword
.

281996

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281996
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18778,TM0115, BV3001, BV1071, 282198 Molecular Weight 58630.14 Da.
    Residues 520 Isoelectric Point 6.37
    Sequence mfpllafrgdrmeilkakgivkrfpgvvavdnvdfevyeneivsligengagkstlikiltgvlkpdag eilvngervefhspvdafkkgisvihqelnlcdnmtvaeniflayeavrgqkrtlssrvdenymytrsk elldligakfspdalvrnlttaqrqmveickalvkepriifmdeptssltveeterlfeiiemlksrgi svvfvshrldevmrisdrivvmrdgkrigelkkgefdvdtiikmmvgreveffphgietrpgeialevr nlkwkdkvknvsfevrkgevlgfaglvgagrtetmllvfgvnqkesgdiyvngrkveiknpedaikmgi glipedrklqglvlrmtvkdnivlpslkkisrwglvlderkeeeisedyvkrlsiktpsiyqitenlsg gnqqkvvlakwlatnadilifdeptrgidvgakaeihrmirelaaqgkavimisselpeilnlsdrivv mwegeitavldnrekrvtqeeimyyasgqkkqngrva
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0115

    Name: D-xylose transport via ABC system
    Other genes that carryout this rxn:TM0114 TM0112 TM0060 TM0058 TM0056 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xyl-D[e] --> adp[c] + h[c] + pi[c] + xyl-D[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0115
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch