.
The Open Protein Structure Annotation Network
PDB Keyword
.

282006

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282006
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18783,TM0125 Molecular Weight 30766.80 Da.
    Residues 282 Isoelectric Point 9.22
    Sequence mdqrnktlrdlpwegerlsffhdlveysflrtafvggilvaslsglvspivvfrrmefigdgtahavfa glaaatligadhrliafatallfafavslfsrsrisessaigillpffmavgvvlfsvsgryqtdvmgy lfgdvllvnstdvaitavvlalsviltvvfrwdikyfivdekmarfygiktdlirflitsfiaitvvtt vkvvgviltgallilpglvskifgksfwslttisvifstgvffagfltaytldlppgpviviiafvsfl pmlkfs
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0125

    Name: zinc transport via ABC system
    Other genes that carryout this rxn: TM0124 TM0123
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + zn2[e] --> adp[c] + h[c] + pi[c] + zn2[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0125
    generated 12/2008
    Transmembrane protein

    HMM_TM0125

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch