.
The Open Protein Structure Annotation Network
PDB Keyword
.

282021

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282021
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18788,TM0141, 530691 Molecular Weight 64266.15 Da.
    Residues 589 Isoelectric Point 5.68
    Sequence mapgrsgyrlrfrsgarisgdseqtqgfvqepgscaedpggivlkrvividnydsfvynivqyigevep dceievfrndeitieeierknpthivispgpgrpeeagisvdvvrhfsgkvpilgvclghqvigyafgg kivhakrilhgktskivhngkgvfsgvknplvatryhslvveeaslpevleitaksddgeimglqhkeh ptfgvqfhpesvlteegkriiknflniqdiqvkkvseeteidivsalkklvefedltfeesrqvmnfim sgnatdaqiagflvalrmkeetgdelggmasvmreksihikapsprtvdtcgtggdgfgtfnistttaf vvaaagipvakhgnrsvsskvgsadvleaggyklektpeemerelketgfsflfapllhpamkhvmpar rqlkirtafnllgpitnparvkyqvvgvfdlsfasklatalqrlgtersavvnggftdelttcgknnll lvtqeeivpmvldpeelglksgdpeelkgpsdpkeayrmmesvlkgeasrtqvetvalnagvvfwlvge cdtikdgvgkaldlirtgeaykklrevmdyqktlgns
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0141

    Name: anthranilate synthase
    Other genes that carryout this rxn:TM0142
    Metabolic Subsystem: Phenylalanine Tyrosine Tryptophan Biosynthesis
    Reaction: : chor + gln-L --> anth + glu-L + h + pyr
    Classification: EC:4.1.3.27
     
    Name: anthranilate phosphoribosyltransferase
    Other genes that carryout this rxn:TM0142
    Metabolic Subsystem: Phenylalanine Tyrosine Tryptophan Biosynthesis
    Reaction: : anth + prpp --> ppi + pran
    Classification: EC:2.4.2.18
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0141
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch