.
The Open Protein Structure Annotation Network
PDB Keyword
.

282047

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Phasing diffraction-data
    Target Id 282047
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1978,TM0167, 289588, 90015 Molecular Weight 43251.05 Da.
    Residues 390 Isoelectric Point 5.09
    Sequence mrvvlivldsvgigempdahlygdegsntivntakavsglhlpnmaklglgnlddipgvepvkpaegiy gkmmekspgkdtttghweiagvilkkpfdlfpegfpkelieeferrtgrkvignkpasgteiikelgpi hektgalivytsadsvfqiaakkeivpleelyryceiarellnemgykvarviarpftgewpnyvrtpe rkdfslepegktlldvltengipvygvgkiadifagrgvtenyktkdnndgidktislmkeknhdclif tnlvdfdtkyghrndpvsyakaleefdarlpeimhnlneddvlfitadhgcdpttpstdhsremvpllg yggrlkkdvyvgiretfadlgqtiadifgvpplengtsfknliwe
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch