.
The Open Protein Structure Annotation Network
PDB Keyword
.

282048

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282048
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1979,TM0168, 530686 Molecular Weight 95619.91 Da.
    Residues 824 Isoelectric Point 5.94
    Sequence mkeyrpqeiekkwqevweekkvfytpqrsekpkyyalvmfpypsgtlhvghvknyvigdivarykrmrg ynvlhpfgydafglpaenaaiekgihpeewtrkniatirqqvkklgisydwsreiatcdeeyykwtqwi flqlyknglaykkkaavnwcpkcktvlaneqvkdgkcercgtsvtirhleqwffkitdyaerllndldk ltgwpehvktmqrnwigkstgaeidfpvegsdtkirvfttrpdtlwgvtfmalapesplveelvpeekk eelqeflervkqqdrfrrtsveaekegfflgryainpvtgeripiyvanyilmeygtgaimgvpahdqr dfsfakkygipikvvikpadkdldpekmeeayegegimvnsgpfdgtpssegiekvinwleekgigkrs vqyklrdwlisrqrywgapipiiycekcgvvpvpeedlpvrlpkdveflptgqsplsfhegfkktkcpv cggeaqretdtmdtfvdsswyflryvnphledkpfepddvnywlpvdqyiggvehavlhllysrfvtkv lhdlgylnfdepftnlftqgmiykdgakmskskgnvvspdemiekygadtlrmyilfmappekdaewsd agiegvhrfvkrlwntfytvlpfvkeentenlvlknstekelrrklhsiikkitedieggfkfntaisg lmelvnhlsqylnsvpqeewnrkllreivekltlalspfaphlaeefwhdlgndslvvqqswpsydpka leveeveiaiqingkvrdkvvvpvdiseedlkrivlerervkeyvdgkpirkfiyvkgrivnivv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0168

    Name: Leucyl-tRNA synthetase
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : atp + leu-L + trnaleu --> amp + leutrna + ppi
    Classification: EC:6.1.1.4
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0168
    generated 12/2008

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch