.
The Open Protein Structure Annotation Network
PDB Keyword
.

282054

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282054
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25549,TM0174 Molecular Weight 77041.91 Da.
    Residues 726 Isoelectric Point 6.15
    Sequence myvaalffliplvalgfaaanfaavvrkpegtermkeissyirsgadsflahetkaifkvaiviaillm ifttwqtgvafllgavmsasagivgmkmatranvrvaeaarttkkigpalkvayqggsvmglsvggfal lglvlvylifgkwmgqvdnlniytnwlginfvpfamtvsgyalgcsiiamfdrvgggvytkaadmaadl vgktelnlpeddprnpatiadnvgdnvgdvaglgadllesfvgaivssiilasymfpiyvqkigenlvh qvpketiqalisypiffalvglgcsmlgilyvivkkpsdnpqrelnislwtsalltvvltafltyfylk dlqgldvvgfrfgaispwfsaiigifsgiligfwaeyytsyrykptqflskssiegtgmvisnglslgm ksvfpptltlvlgilfadyfaglygvaiaalgmlsfvatsvsvdsygpiadnaggisemceldpevrki tdhldavgnttaaigkgfaigsaifaalslfasymfsqispsdigkppslvlllnmldarviagallga aityyfsgylisavtkaamkmvdeirrqareipgllegkakpdynrcieitsdnalkqmgypafiailt plvtgfllgaefvggvligtvlsgamlailtansggawdnakkyleagnlegygkgsephkalvigdtv gdplkdtvgpsldilikimsvvsviavsifkhvhlf
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0174

    Name: inorganic diphosphatase (one proton translocation)
    Metabolic Subsystem: Energy Metabolism
    Reaction: h2o[c] + ppi[c] --> h[e] + pi[c]
    Classification: EC:3.6.1.1
     

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0174

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch